Lineage for d4inxa_ (4inx A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2325006Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2325007Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 2325078Protein automated matches [190345] (4 species)
    not a true protein
  7. 2325079Species Amyelois transitella [TaxId:680683] [193910] (3 PDB entries)
  8. 2325081Domain d4inxa_: 4inx A: [193912]
    automated match to d2jpoa1
    complexed with 1ex

Details for d4inxa_

PDB Entry: 4inx (more details), 1.85 Å

PDB Description: Structure of Pheromone-binding protein 1 in complex with (Z,Z)-11,13- hexadecadienol
PDB Compounds: (A:) Pheromone-binding protein 1

SCOPe Domain Sequences for d4inxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4inxa_ a.39.2.1 (A:) automated matches {Amyelois transitella [TaxId: 680683]}
speimkdlsinfgkaldtckkeldlpdsinedfykfwkedyeitnrltgcaikclsekle
mvdadgklhhgnarefamkhgaddamakqlvdlihgceksippnddrcmevlsiamcfkk
eihnlkwapnmevvvgevla

SCOPe Domain Coordinates for d4inxa_:

Click to download the PDB-style file with coordinates for d4inxa_.
(The format of our PDB-style files is described here.)

Timeline for d4inxa_: