SCOPe 2.02: Domain d4inxa_: 4inx A:

Lineage for d4inxa_ (4inx A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)

6. Protein automated matches [190345] (3 species)
   not a true protein

7. Species Amyelois transitella [TaxId:680683] [193910] (2 PDB entries)

8. Domain d4inxa_: 4inx A: [193912]
   automated match to d2jpoa1
   complexed with 1ex

Details for d4inxa_

PDB Entry: 4inx, 1.85 Å

PDB Description: Structure of Pheromone-binding protein 1 in complex with (Z,Z)-11,13- hexadecadienol

PDB Compounds: (A:) Pheromone-binding protein 1

SCOPe Domain Sequences for d4inxa_:

Sequence; same for both SEQRES and ATOM records:

>d4inxa_ a.39.2.1 (A:) automated matches {Amyelois transitella [TaxId: 680683]}
speimkdlsinfgkaldtckkeldlpdsinedfykfwkedyeitnrltgcaikclsekle
mvdadgklhhgnarefamkhgaddamakqlvdlihgceksippnddrcmevlsiamcfkk
eihnlkwapnmevvvgevla

Timeline for d4inxa_:

• d4inxa_ is new in SCOPe 2.02-stable
  
• d4inxa_ appears in SCOPe 2.03
  
• d4inxa_ appears in the current release, SCOPe 2.08