Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) automatically mapped to Pfam PF01395 |
Protein automated matches [190345] (3 species) not a true protein |
Species Amyelois transitella [TaxId:680683] [193910] (3 PDB entries) |
Domain d4inwa_: 4inw A: [193911] automated match to d2jpoa1 complexed with 1ey |
PDB Entry: 4inw (more details), 1.14 Å
SCOPe Domain Sequences for d4inwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4inwa_ a.39.2.1 (A:) automated matches {Amyelois transitella [TaxId: 680683]} speimkdlsinfgkaldtckkeldlpdsinedfykfwkedyeitnrltgcaikclsekle mvdadgklhhgnarefamkhgaddamakqlvdlihgceksippnddrcmevlsiamcfkk eihnlkwapnmevvvgevla
Timeline for d4inwa_: