SCOPe 2.05: Domain d4inwa_: 4inw A:

Lineage for d4inwa_ (4inw A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein automated matches [190345] (3 species)
   not a true protein

7. Species Amyelois transitella [TaxId:680683] [193910] (3 PDB entries)

8. Domain d4inwa_: 4inw A: [193911]
   automated match to d2jpoa1
   complexed with 1ey

Details for d4inwa_

PDB Entry: 4inw, 1.14 Å

PDB Description: Structure of Pheromone-binding protein 1 in complex with (11Z,13Z)-hexadecadienal

PDB Compounds: (A:) Pheromone-binding protein 1

SCOPe Domain Sequences for d4inwa_:

Sequence; same for both SEQRES and ATOM records:

>d4inwa_ a.39.2.1 (A:) automated matches {Amyelois transitella [TaxId: 680683]}
speimkdlsinfgkaldtckkeldlpdsinedfykfwkedyeitnrltgcaikclsekle
mvdadgklhhgnarefamkhgaddamakqlvdlihgceksippnddrcmevlsiamcfkk
eihnlkwapnmevvvgevla

Timeline for d4inwa_:

• d4inwa_ first appeared in SCOPe 2.02
  
• d4inwa_ appears in SCOPe 2.04
  
• d4inwa_ appears in SCOPe 2.06
  
• d4inwa_ appears in the current release, SCOPe 2.08