Lineage for d3vhwa_ (3vhw A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009537Domain d3vhwa_: 3vhw A: [193906]
    automated match to d1ie9a_
    complexed with vhw

Details for d3vhwa_

PDB Entry: 3vhw (more details), 2.43 Å

PDB Description: crystal structure of the human vitamin d receptor ligand binding domain complexed with 4-mp
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d3vhwa_:

Sequence, based on SEQRES records: (download)

>d3vhwa_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp
hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc
gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd
aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp
ecsmkltplvlevfg

Sequence, based on observed residues (ATOM records): (download)

>d3vhwa_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndggsvtlelsqlsmlph
ladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcg
nqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqda
alieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpe
csmkltplvlevfg

SCOPe Domain Coordinates for d3vhwa_:

Click to download the PDB-style file with coordinates for d3vhwa_.
(The format of our PDB-style files is described here.)

Timeline for d3vhwa_: