SCOPe 2.08: Domain d3bj911: 3bj9 1:3-116

Lineage for d3bj911 (3bj9 1:3-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3bj911: 3bj9 1:3-116 [193896]
   Other proteins in same PDB: d3bj912
   automated match to d2cd0a_
   complexed with edo

Details for d3bj911

PDB Entry: 3bj9, 2 Å

PDB Description: crystal structure of the surrogate light chain variable domain vprebj

PDB Compounds: (1:) Immunoglobulin iota chain, Immunoglobulin lambda-like polypeptide 1

SCOPe Domain Sequences for d3bj911:

Sequence; same for both SEQRES and ATOM records:

>d3bj911 b.1.1.0 (1:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlhqppamssalgttirltctlrndhdigvysvywyqqrpghpprfllryfsqsdksqgp
qvpprfsgskdvarnrgylsiselqpedeamyycamgarsthvfgsgtqltvls

Timeline for d3bj911:

• d3bj911 first appeared in SCOPe 2.02, called d3bj91_
  
• d3bj911 appears in SCOPe 2.07