Lineage for d2osvb_ (2osv B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143580Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2143581Protein automated matches [190944] (35 species)
    not a true protein
  7. 2143601Species Escherichia coli [TaxId:562] [193890] (6 PDB entries)
  8. 2143603Domain d2osvb_: 2osv B: [193891]
    automated match to d2xy4a_
    complexed with zn

Details for d2osvb_

PDB Entry: 2osv (more details), 1.75 Å

PDB Description: Crystal Structure of ZnuA from E. coli
PDB Compounds: (B:) High-affinity zinc uptake system protein znuA

SCOPe Domain Sequences for d2osvb_:

Sequence, based on SEQRES records: (download)

>d2osvb_ c.92.2.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
avvaslkpvgfiasaiadgvtetevllpdgasehdyslrpsdvkrlqnadlvvwvgpeme
afmqkpvsklpgakqvtiaqledvkpllmksihgddddhdhaeksdedhhhgdfnmhlwl
speiaratavaihgklvelmpqsrakldanlkdfeaqlastetqvgnelaplkgkgyfvf
hdaygyfekqfgltplghftvnpeiqpgaqrlheirtqlveqkatcvfaepqfrpavves
vargtsvrmgtldplgtniklgktsyseflsqlanqyasclkg

Sequence, based on observed residues (ATOM records): (download)

>d2osvb_ c.92.2.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
avvaslkpvgfiasaiadgvtetevllpdgasehdyslrpsdvkrlqnadlvvwvgpeme
afmqkpvsklpgakqvtiaqledvkpllmksidfnmhlwlspeiaratavaihgklvelm
pqsrakldanlkdfeaqlastetqvgnelaplkgkgyfvfhdaygyfekqfgltplghft
vnpeiqpgaqrlheirtqlveqkatcvfaepqfrpavvesvargtsvrmgtldplgtnik
lgktsyseflsqlanqyasclkg

SCOPe Domain Coordinates for d2osvb_:

Click to download the PDB-style file with coordinates for d2osvb_.
(The format of our PDB-style files is described here.)

Timeline for d2osvb_: