SCOPe 2.08: Domain d2i25n1: 2i25 N:2-112

Lineage for d2i25n1 (2i25 N:2-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (4 PDB entries)

8. Domain d2i25n1: 2i25 N:2-112 [193885]
   Other proteins in same PDB: d2i25l_, d2i25m_, d2i25n2, d2i25o2
   automated match to d2i25o_

Details for d2i25n1

PDB Entry: 2i25, 1.8 Å

PDB Description: Crystal structure analysis of the nurse shark New antigen Receptor PBLA8 variable domain in complex with lysozyme

PDB Compounds: (N:) New Antigen Receptor PBLA8

SCOPe Domain Sequences for d2i25n1:

Sequence; same for both SEQRES and ATOM records:

>d2i25n1 b.1.1.1 (N:2-112) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqritketgesltincvvrdsrcvlstgywyrkppgsrneesisdggryvetvnr
gsksfslrindltvkdsgtyrckpesrygsydavcaalndqygggtvvtvn

Timeline for d2i25n1:

• d2i25n1 first appeared in SCOPe 2.02, called d2i25n_
  
• d2i25n1 appears in SCOPe 2.07