SCOPe 2.03: Domain d2j3pb_: 2j3p B:

Lineage for d2j3pb_ (2j3p B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein automated matches [190637] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188437] (2 PDB entries)

8. Domain d2j3pb_: 2j3p B: [193884]
   automated match to d2uusa_
   complexed with so4

Details for d2j3pb_

PDB Entry: 2j3p, 1.4 Å

PDB Description: crystal structure of rat fgf1 at 1.4 a

PDB Compounds: (B:) heparin-binding growth factor 1

SCOPe Domain Sequences for d2j3pb_:

Sequence; same for both SEQRES and ATOM records:

>d2j3pb_ b.42.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesagevyikgtetgqylamd
tegllygsqtpneeclflerleenhyntytskkhaeknwfvglkkngsckrgprthygqk
ailflplpvssd

Timeline for d2j3pb_:

• d2j3pb_ first appeared in SCOPe 2.02
  
• d2j3pb_ appears in SCOPe 2.04
  
• d2j3pb_ appears in the current release, SCOPe 2.08