SCOPe 2.04: Domain d2fl1d_: 2fl1 D:

Lineage for d2fl1d_ (2fl1 D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (18 species)
   not a true protein

7. Species Zoanthus sp. [TaxId:105402] [193832] (8 PDB entries)

8. Domain d2fl1d_: 2fl1 D: [193880]
   automated match to d1xssa_
   complexed with so4

Details for d2fl1d_

PDB Entry: 2fl1, 2.4 Å

PDB Description: crystal structure of red fluorescent protein from zoanthus, zrfp574, at 2.4a resolution

PDB Compounds: (D:) Red fluorescent protein zoanRFP

SCOPe Domain Sequences for d2fl1d_:

Sequence; same for both SEQRES and ATOM records:

>d2fl1d_ d.22.1.0 (D:) automated matches {Zoanthus sp. [TaxId: 105402]}
sahgltddmtmhfrmegcvdghkfviegngngnpfkgkqfinlcvieggplpfsedilsa
afdygnrlfteypegivdyfknscpagytwhrsfrfedgavcicsaditvnvrenciyhe
stfygvnfpadgpvmkkmttnwepscekiipinsqkilkgdvsmylllkdggryrcqfdt
iykaktepkempdwhfiqhklnredrsdaknqkwqliehaiasrsalp

Timeline for d2fl1d_:

• d2fl1d_ first appeared in SCOPe 2.02
  
• d2fl1d_ appears in SCOPe 2.03
  
• d2fl1d_ appears in SCOPe 2.05
  
• d2fl1d_ appears in the current release, SCOPe 2.08