| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
| Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
| Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
| Species Human (Homo sapiens) [TaxId:9606] [48555] (69 PDB entries) Uniprot P02768 29-596 |
| Domain d1bkea2: 1bke A:197-388 [19388] complexed with b3i, myr |
PDB Entry: 1bke (more details), 3.15 Å
SCOPe Domain Sequences for d1bkea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bkea2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli
Timeline for d1bkea2: