![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
![]() | Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
![]() | Protein automated matches [190944] (40 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [193874] (1 PDB entry) |
![]() | Domain d2o1eb_: 2o1e B: [193875] automated match to d3cx3a_ complexed with mn |
PDB Entry: 2o1e (more details), 2.6 Å
SCOPe Domain Sequences for d2o1eb_:
Sequence, based on SEQRES records: (download)
>d2o1eb_ c.92.2.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} klhvvttfypmyeftkqivkdkgdvdllipssvephdweptpkdianiqdadlfvynsey metwvpsaeksmgqghavfvnaskgidlmegseeeheehdhgehehshamdphvwlspvl aqkevknitaqivkqdpdnkeyyeknskeyiaklqdldklyrttakkaekkefitqhtaf gylakeyglkqvpiaglspdqepsaaslaklktyakehnvkviyfeeiasskvadtlase igaktevlntleglskeeqdkglgyidimkqnldalkdsll
>d2o1eb_ c.92.2.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} klhvvttfypmyeftkqivkdkgdvdllipssvephdweptpkdianiqdadlfvynsey metwvpsaeksmgqghavfvnaskgidlmegamdphvwlspvlaqkevknitaqivkqdp dnkeyyeknskeyiaklqdldklyrttakkaekkefitqhtafgylakeyglkqvpiagl spdqepsaaslaklktyakehnvkviyfeeiasskvadtlaseigaktevlntleglske eqdkglgyidimkqnldalkdsll
Timeline for d2o1eb_: