Lineage for d1bke_1 (1bke 4-196)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.126: Serum albumin [48551] (1 superfamily) Superfamily a.126.1: Serum albumin [48552] (1 family) 
Family a.126.1.1: Serum albumin [48553] (1 protein) Protein Serum albumin [48554] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48555] (13 PDB entries) 
Domain d1bke_1: 1bke 4-196 [19387]
Details for d1bke_1
PDB Entry: 1bke (more details), 3.15 Å
PDB Description: human serum albumin in a complex with myristic acid and tri-iodobenzoic acid
SCOP Domain Sequences for d1bke_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bke_1 a.126.1.1 (4-196) Serum albumin {Human (Homo sapiens)}
ksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencd
kslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvm
ctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkld
elrdegkassakq
SCOP Domain Coordinates for d1bke_1:
Click to download the PDB-style file with coordinates for d1bke_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bke_1:
- d1bke_1 appears in SCOP 1.57
- d1bke_1 appears in the current release, SCOPe 2.08, called d1bkea1
View in 3D
