| Class b: All beta proteins [48724] (174 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (7 families) ![]() |
| Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
| Protein automated matches [190198] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186941] (25 PDB entries) |
| Domain d2j20b_: 2j20 B: [193868] automated match to d3igla_ complexed with so4, zn; mutant |
PDB Entry: 2j20 (more details), 1.8 Å
SCOPe Domain Sequences for d2j20b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j20b_ b.2.5.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgtr
vramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhsv
vvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevcvca
cpgrdrrteeenlr
Timeline for d2j20b_: