SCOPe 2.08: Domain d2gixd1: 2gix D:44-369

Lineage for d2gixd1 (2gix D:44-369)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein automated matches [190782] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188028] (10 PDB entries)

8. Domain d2gixd1: 2gix D:44-369 [193865]
   Other proteins in same PDB: d2gixa2, d2gixb2, d2gixc2, d2gixd2
   automated match to d2e4fa_
   complexed with k, mpd; mutant

Details for d2gixd1

PDB Entry: 2gix, 2.02 Å

PDB Description: cytoplasmic domain structure of kir2.1 containing andersen's mutation r218q and rescue mutation t309k

PDB Compounds: (D:) Inward rectifier potassium channel 2

SCOPe Domain Sequences for d2gixd1:

Sequence; same for both SEQRES and ATOM records:

>d2gixd1 b.1.18.16 (D:44-369) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlqkshlveahv
raqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlskqdi
dnadfeivvilegmveatamtkqcrssylaneilwghryepvlfeekhyykvdysrfhkt
yevpntplcsardlaekkyils

Timeline for d2gixd1:

• d2gixd1 first appeared in SCOPe 2.02, called d2gixd_
  
• d2gixd1 appears in SCOPe 2.07