Lineage for d2gixd1 (2gix D:44-369)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362645Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)
  6. 2362663Protein automated matches [190782] (2 species)
    not a true protein
  7. 2362670Species Mouse (Mus musculus) [TaxId:10090] [188028] (10 PDB entries)
  8. 2362676Domain d2gixd1: 2gix D:44-369 [193865]
    Other proteins in same PDB: d2gixa2, d2gixb2, d2gixc2, d2gixd2
    automated match to d2e4fa_
    complexed with k, mpd; mutant

Details for d2gixd1

PDB Entry: 2gix (more details), 2.02 Å

PDB Description: cytoplasmic domain structure of kir2.1 containing andersen's mutation r218q and rescue mutation t309k
PDB Compounds: (D:) Inward rectifier potassium channel 2

SCOPe Domain Sequences for d2gixd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gixd1 b.1.18.16 (D:44-369) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlqkshlveahv
raqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlskqdi
dnadfeivvilegmveatamtkqcrssylaneilwghryepvlfeekhyykvdysrfhkt
yevpntplcsardlaekkyils

SCOPe Domain Coordinates for d2gixd1:

Click to download the PDB-style file with coordinates for d2gixd1.
(The format of our PDB-style files is described here.)

Timeline for d2gixd1: