Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (25 species) not a true protein |
Species Mus musculus [TaxId:10090] [193863] (1 PDB entry) |
Domain d2ho4b_: 2ho4 B: [193864] automated match to d3hlta_ complexed with mg, po4 |
PDB Entry: 2ho4 (more details), 2.2 Å
SCOPe Domain Sequences for d2ho4b_:
Sequence, based on SEQRES records: (download)
>d2ho4b_ c.108.1.0 (B:) automated matches {Mus musculus [TaxId: 10090]} lkavlvdlngtlhiedaavpgaqealkrlratsvmvrfvtnttketkkdllerlkklefe isedeiftsltaarnlieqkqvrpmlllddralpeftgvqtqdpnavviglapehfhyql lnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkamvvgkpektffl ealrdadcapeeavmigddcrddvdgaqnigmlgilvktgkykaadeekinpppyltces fphavdhilqhll
>d2ho4b_ c.108.1.0 (B:) automated matches {Mus musculus [TaxId: 10090]} lkavlvdlngtlhiedaavpgaqealkrlratsvmvrfvtnttketkkdllerlkklefe isedeiftsltaarnlieqkqvrpmlllddralpeftgvqtqdpnavviglapehfhyql lnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkamvvgkpektffl ealrdadcapeavmigddcrddvdgaqnigmlgilvktgkykaadeekinpppyltcesf phavdhilqhll
Timeline for d2ho4b_: