Lineage for d2ho4b_ (2ho4 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149297Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2149298Protein automated matches [190447] (51 species)
    not a true protein
  7. 2149570Species Mouse (Mus musculus) [TaxId:10090] [193863] (7 PDB entries)
  8. 2149579Domain d2ho4b_: 2ho4 B: [193864]
    automated match to d3hlta_
    complexed with mg, po4

Details for d2ho4b_

PDB Entry: 2ho4 (more details), 2.2 Å

PDB Description: crystal structure of protein from mouse mm.236127
PDB Compounds: (B:) Haloacid dehalogenase-like hydrolase domain containing 2

SCOPe Domain Sequences for d2ho4b_:

Sequence, based on SEQRES records: (download)

>d2ho4b_ c.108.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lkavlvdlngtlhiedaavpgaqealkrlratsvmvrfvtnttketkkdllerlkklefe
isedeiftsltaarnlieqkqvrpmlllddralpeftgvqtqdpnavviglapehfhyql
lnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkamvvgkpektffl
ealrdadcapeeavmigddcrddvdgaqnigmlgilvktgkykaadeekinpppyltces
fphavdhilqhll

Sequence, based on observed residues (ATOM records): (download)

>d2ho4b_ c.108.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lkavlvdlngtlhiedaavpgaqealkrlratsvmvrfvtnttketkkdllerlkklefe
isedeiftsltaarnlieqkqvrpmlllddralpeftgvqtqdpnavviglapehfhyql
lnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkamvvgkpektffl
ealrdadcapeavmigddcrddvdgaqnigmlgilvktgkykaadeekinpppyltcesf
phavdhilqhll

SCOPe Domain Coordinates for d2ho4b_:

Click to download the PDB-style file with coordinates for d2ho4b_.
(The format of our PDB-style files is described here.)

Timeline for d2ho4b_: