Lineage for d1xaeb_ (1xae B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2941147Species Zoanthus sp. [TaxId:105402] [193832] (10 PDB entries)
  8. 2941169Domain d1xaeb_: 1xae B: [193851]
    automated match to d2dddb_
    complexed with bme

Details for d1xaeb_

PDB Entry: 1xae (more details), 2.7 Å

PDB Description: crystal structure of wild type yellow fluorescent protein zfp538 from zoanthus
PDB Compounds: (B:) fluorescent protein fp538

SCOPe Domain Sequences for d1xaeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xaeb_ d.22.1.0 (B:) automated matches {Zoanthus sp. [TaxId: 105402]}
hglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedilsagf
kygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenciyhksi
fngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcqfdtvy
kaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsa

SCOPe Domain Coordinates for d1xaeb_:

Click to download the PDB-style file with coordinates for d1xaeb_.
(The format of our PDB-style files is described here.)

Timeline for d1xaeb_: