| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [193845] (8 PDB entries) |
| Domain d1z6ga_: 1z6g A: [193846] automated match to d2qora_ complexed with epe, so4 |
PDB Entry: 1z6g (more details), 2.18 Å
SCOPe Domain Sequences for d1z6ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6ga_ c.37.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
niyplvicgpsgvgkgtlikkllnefpnyfyfsvscttrkkrekekegvdyyfidktife
dklknedfleydnyannfygtlkseydkakeqnkiclfemningvkqlkksthiknalyi
fikppstdvllsrlltrntenqeqiqkrmeqlnielheanllnfnlsiinddltltyqql
knyllnsyihl
Timeline for d1z6ga_: