Lineage for d1x8ba_ (1x8b A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (29 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1125 PDB entries)
  8. 2546453Domain d1x8ba_: 1x8b A: [193843]
    automated match to d2a1ab_
    complexed with 824, mg

Details for d1x8ba_

PDB Entry: 1x8b (more details), 1.81 Å

PDB Description: Structure of human Wee1A kinase: kinase domain complexed with inhibitor PD0407824
PDB Compounds: (A:) Wee1-like protein kinase

SCOPe Domain Sequences for d1x8ba_:

Sequence, based on SEQRES records: (download)

>d1x8ba_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mksryttefhelekigsgefgsvfkcvkrldgciyaikrskkplagsvdeqnalrevyah
avlgqhshvvryfsawaeddhmliqneycnggsladaisenyrimsyfkeaelkdlllqv
grglryihsmslvhmdikpsnifisrtsipnaaseegdeddwasnkvmfkigdlghvtri
sspqveegdsrflanevlqenythlpkadifalaltvvcaagaeplprngdqwheirqgr
lpripqvlsqeftellkvmihpdperrpsamalvkhsvl

Sequence, based on observed residues (ATOM records): (download)

>d1x8ba_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mksryttefhelekigsgefgsvfkcvkrldgciyaikrskkplagsvdeqnalrevyah
avlgqhshvvryfsawaeddhmliqneycnggsladaisenyrimsyfkeaelkdlllqv
grglryihsmslvhmdikpsnifiskvmfkigdlghvtrisspqveegdsrflanevlqe
nythlpkadifalaltvvcaagaeplprngdqwheirqgrlpripqvlsqeftellkvmi
hpdperrpsamalvkhsvl

SCOPe Domain Coordinates for d1x8ba_:

Click to download the PDB-style file with coordinates for d1x8ba_.
(The format of our PDB-style files is described here.)

Timeline for d1x8ba_: