SCOPe 2.07: Domain d1yzzb1: 1yzz B:1-116

Lineage for d1yzzb1 (1yzz B:1-116)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d1yzzb1: 1yzz B:1-116 [193841]
   Other proteins in same PDB: d1yzza2, d1yzzb2
   automated match to d1yc7b_

Details for d1yzzb1

PDB Entry: 1yzz, 2.7 Å

PDB Description: Humanized caban33 at room temperature

PDB Compounds: (B:) anti-VSG immunoglobulin heavy chain variable domain cAbAn33

SCOPe Domain Sequences for d1yzzb1:

Sequence, based on SEQRES records:

>d1yzzb1 b.1.1.1 (B:1-116) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyq
dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtv

Sequence, based on observed residues (ATOM records):

>d1yzzb1 b.1.1.1 (B:1-116) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyq
dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgvireywgqgtqvtv

Timeline for d1yzzb1:

• d1yzzb1 first appeared in SCOPe 2.02, called d1yzzb_
  
• d1yzzb1 was called d1yzzb_ in SCOPe 2.06
  
• d1yzzb1 appears in the current release, SCOPe 2.08