| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (22 species) not a true protein |
| Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries) |
| Domain d1yzzb_: 1yzz B: [193841] automated match to d1yc7b_ |
PDB Entry: 1yzz (more details), 2.7 Å
SCOPe Domain Sequences for d1yzzb_:
Sequence, based on SEQRES records: (download)
>d1yzzb_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyq
dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvs
>d1yzzb_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyq
dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgvireywgqgtqvtvs
Timeline for d1yzzb_: