SCOP 1.75: Domain d1e7ia1: 1e7i A:3-196

Lineage for d1e7ia1 (1e7i A:3-196)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (50 PDB entries)
   Uniprot P02768 29-596

8. Domain d1e7ia1: 1e7i A:3-196 [19384]

Details for d1e7ia1

PDB Entry: 1e7i, 2.7 Å

PDB Description: human serum albumin complexed with octadecanoic acid (stearic acid)

PDB Compounds: (A:) serum albumin

SCOP Domain Sequences for d1e7ia1:

Sequence; same for both SEQRES and ATOM records:

>d1e7ia1 a.126.1.1 (A:3-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

Timeline for d1e7ia1:

• d1e7ia1 first appeared (with stable ids) in SCOP 1.55
  
• d1e7ia1 appears in SCOP 1.73
  
• d1e7ia1 appears in SCOPe 2.01
  
• d1e7ia1 appears in the current release, SCOPe 2.08