Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.12: IgG-specific endopeptidase IdeS (Sib38) [117762] (2 proteins) automatically mapped to Pfam PF09028 |
Protein automated matches [193829] (1 species) not a true protein |
Species Streptococcus pyogenes [TaxId:293653] [193830] (1 PDB entry) |
Domain d2avwf_: 2avw F: [193831] automated match to d2au1a_ complexed with gol, so4 |
PDB Entry: 2avw (more details), 2 Å
SCOPe Domain Sequences for d2avwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avwf_ d.3.1.12 (F:) automated matches {Streptococcus pyogenes [TaxId: 293653]} vtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllagaatagnmlhwwf dqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylstk hlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdf keknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyvtdsds nasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswn
Timeline for d2avwf_: