Lineage for d2gjta1 (2gjt A:916-1208)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2455001Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2455002Protein automated matches [190475] (8 species)
    not a true protein
  7. 2455014Species Human (Homo sapiens) [TaxId:9606] [187400] (118 PDB entries)
  8. 2455070Domain d2gjta1: 2gjt A:916-1208 [193823]
    Other proteins in same PDB: d2gjta2, d2gjtb2
    automated match to d2hc1a_
    complexed with cl

Details for d2gjta1

PDB Entry: 2gjt (more details), 2.15 Å

PDB Description: Crystal structure of the human receptor phosphatase PTPRO
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase PTPRO

SCOPe Domain Sequences for d2gjta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjta1 c.45.1.0 (A:916-1208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npvqlddfdayikdmakdsdykfslqfeelkligldiphfaadlplnrcknrytnilpyd
fsrvrlvsmneeegadyinanyipgynspqeyiatqgplpetrndfwkmvlqqksqiivm
ltqcnekrrvkcdhywpfteepiaygditvemiseeeqddwacrhfrinyademqdvmhf
nytawpdhgvptanaaesilqfvhmvrqqatkskgpmiihcsagvgrtgtfialdrllqh
irdhefvdilglvsemrsyrmsmvqteeqyifihqcvqlmwmkkkqqfcisdv

SCOPe Domain Coordinates for d2gjta1:

Click to download the PDB-style file with coordinates for d2gjta1.
(The format of our PDB-style files is described here.)

Timeline for d2gjta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gjta2