SCOPe 2.02: Domain d1zxkb_: 1zxk B:

Lineage for d1zxkb_ (1zxk B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187373] (2 PDB entries)

8. Domain d1zxkb_: 1zxk B: [193822]
   automated match to d2a4ca_

Details for d1zxkb_

PDB Entry: 1zxk, 2 Å

PDB Description: crystal structure of cadherin8 ec1 domain

PDB Compounds: (B:) Cadherin-8

SCOPe Domain Sequences for d1zxkb_:

Sequence, based on SEQRES records:

>d1zxkb_ b.1.6.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
swvwnqmfvleefsgpepilvgrlhtdldpgskkikyilsgdgagtifqinditgdihai
krldreekaeytltaqavdfetnkpleppsefiikvqd

Sequence, based on observed residues (ATOM records):

>d1zxkb_ b.1.6.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
swvwnqmfvleefsgpepilvgrlhtdldkikyilsgdgagtifqinditgdihaikrld
reekaeytltaqavdfetnkpleppsefiikvqd

Timeline for d1zxkb_:

• d1zxkb_ is new in SCOPe 2.02-stable
  
• d1zxkb_ appears in SCOPe 2.03
  
• d1zxkb_ appears in the current release, SCOPe 2.08