Lineage for d2iu4b_ (2iu4 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1630265Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 1630266Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 1630313Family c.119.1.0: automated matches [191443] (1 protein)
    not a true family
  6. 1630314Protein automated matches [190655] (9 species)
    not a true protein
  7. 1630322Species Lactococcus lactis [TaxId:1358] [188636] (3 PDB entries)
  8. 1630324Domain d2iu4b_: 2iu4 B: [193815]
    automated match to d3ct4a_
    complexed with so4

Details for d2iu4b_

PDB Entry: 2iu4 (more details), 1.96 Å

PDB Description: dihydroxyacetone kinase operon co-activator dha-dhaq
PDB Compounds: (B:) dihydroxyacetone kinase

SCOPe Domain Sequences for d2iu4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iu4b_ c.119.1.0 (B:) automated matches {Lactococcus lactis [TaxId: 1358]}
efynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvgy
vgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikearte
gidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslspe
iytlgvalapvhfphqktsfvlaedevsfgigihgepgyrvekfegseriaielvnklka
einwqkkanknyillvnglgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdms
gisltlcsvkdpkwldylnvptgafawlehh

SCOPe Domain Coordinates for d2iu4b_:

Click to download the PDB-style file with coordinates for d2iu4b_.
(The format of our PDB-style files is described here.)

Timeline for d2iu4b_: