Lineage for d3m8ua_ (3m8u A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2145824Species Haemophilus parasuis [TaxId:557723] [193812] (1 PDB entry)
  8. 2145825Domain d3m8ua_: 3m8u A: [193813]
    automated match to d3tpaa_
    complexed with gds, mli

Details for d3m8ua_

PDB Entry: 3m8u (more details), 1.85 Å

PDB Description: Crystal structure of glutathione-binding protein A (GbpA) from Haemophilus parasuis SH0165 in complex with glutathione disulfide (GSSG)
PDB Compounds: (A:) heme-binding protein a

SCOPe Domain Sequences for d3m8ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m8ua_ c.94.1.0 (A:) automated matches {Haemophilus parasuis [TaxId: 557723]}
dktfincvsrsptgfspalvmdgisynassqqvynrlvefkrgstdiepalaeswtvsdd
gltytfnlrkgvkfhsnkeftpsrdfnaddvvfsfqrqldpnhpyhnvskatypyfkamk
fstllksvekvdmhtvkitlnrqdatflaslgmdfisiysaeyadkmlaagkpetidttp
igtgpflfagyqvdqksrylahkeywkgkadidrlifeivpdataryaklqagacdlidf
pnaadlekmktdpkvnlhsqsglniayiafntekapfdnvkvrqalnyavdknaiidavy
rgagvaaknplpptiwgynneitgyeyspekakqllkeagfengfetdiwvqpvvrasnp
nprrmaelvqsdwekvgvksklvsyewgdyikrtkageltagtygwsgdngdpdnflspl
fgsenvgnsnyarfknpeldallhkavglsdkaerakiyeqaqvllkeqapwinvahsin
faptskrvqdykqspfgytylygtklad

SCOPe Domain Coordinates for d3m8ua_:

Click to download the PDB-style file with coordinates for d3m8ua_.
(The format of our PDB-style files is described here.)

Timeline for d3m8ua_: