SCOPe 2.08: Domain d3m8ua_: 3m8u A:

Lineage for d3m8ua_ (3m8u A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Haemophilus parasuis [TaxId:557723] [193812] (1 PDB entry)

8. Domain d3m8ua_: 3m8u A: [193813]
   automated match to d3tpaa_
   complexed with gds, mli

Details for d3m8ua_

PDB Entry: 3m8u, 1.85 Å

PDB Description: Crystal structure of glutathione-binding protein A (GbpA) from Haemophilus parasuis SH0165 in complex with glutathione disulfide (GSSG)

PDB Compounds: (A:) heme-binding protein a

SCOPe Domain Sequences for d3m8ua_:

Sequence; same for both SEQRES and ATOM records:

>d3m8ua_ c.94.1.0 (A:) automated matches {Haemophilus parasuis [TaxId: 557723]}
dktfincvsrsptgfspalvmdgisynassqqvynrlvefkrgstdiepalaeswtvsdd
gltytfnlrkgvkfhsnkeftpsrdfnaddvvfsfqrqldpnhpyhnvskatypyfkamk
fstllksvekvdmhtvkitlnrqdatflaslgmdfisiysaeyadkmlaagkpetidttp
igtgpflfagyqvdqksrylahkeywkgkadidrlifeivpdataryaklqagacdlidf
pnaadlekmktdpkvnlhsqsglniayiafntekapfdnvkvrqalnyavdknaiidavy
rgagvaaknplpptiwgynneitgyeyspekakqllkeagfengfetdiwvqpvvrasnp
nprrmaelvqsdwekvgvksklvsyewgdyikrtkageltagtygwsgdngdpdnflspl
fgsenvgnsnyarfknpeldallhkavglsdkaerakiyeqaqvllkeqapwinvahsin
faptskrvqdykqspfgytylygtklad

Timeline for d3m8ua_:

• d3m8ua_ first appeared in SCOPe 2.02
  
• d3m8ua_ appears in SCOPe 2.07