Lineage for d1e7ga1 (1e7g A:3-196)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.126: Serum albumin [48551] (1 superfamily) Superfamily a.126.1: Serum albumin [48552] (1 family) 
Family a.126.1.1: Serum albumin [48553] (1 protein) Protein Serum albumin [48554] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48555] (13 PDB entries) 
Domain d1e7ga1: 1e7g A:3-196 [19381]
Details for d1e7ga1
PDB Entry: 1e7g (more details), 2.5 Å
PDB Description: Human serum albumin complexed with tetradecanoic acid (myristic acid)
SCOP Domain Sequences for d1e7ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7ga1 a.126.1.1 (A:3-196) Serum albumin {Human (Homo sapiens)}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq
SCOP Domain Coordinates for d1e7ga1:
Click to download the PDB-style file with coordinates for d1e7ga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e7ga1:
- d1e7ga1 appears in SCOP 1.57
- d1e7ga1 appears in the current release, SCOPe 2.08
View in 3D
