Lineage for d3riqa_ (3riq A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069351Family b.80.1.0: automated matches [191490] (1 protein)
    not a true family
  6. 2069352Protein automated matches [190791] (5 species)
    not a true protein
  7. 2069368Species Siphovirus 9na [193807] (1 PDB entry)
  8. 2069369Domain d3riqa_: 3riq A: [193808]
    automated match to d1qa1a_
    complexed with gol

Details for d3riqa_

PDB Entry: 3riq (more details), 1.5 Å

PDB Description: Siphovirus 9NA tailspike receptor binding domain
PDB Compounds: (A:) tailspike protein

SCOPe Domain Sequences for d3riqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3riqa_ b.80.1.0 (A:) automated matches {Siphovirus 9na}
frseadkkfkysvklsdymtlqeaataavdsllididynfidgeavdfggkvltieckak
figdgvlnwnnlgsgskvisphmhtkttpytvyrfddngnwvtnpttvlasvaqrldkgy
kpnvndhdiwaslpdnvknqvagatlrvnsanniifthpeatmggylftlcnhilvespr
nfiawesgitfenhhttawgtgnkvvggeikygsgsavlfirndggddhdggvrdlisyr
vgesgvktyqneiggrsarnyrlvfdnittiqcyydgidvnadtgsptervddytlaeyp
wfqlptqhiirniitrdcmgigawwdgqkniidnvvtyeahkegmfdrgtnnditnitvv
cankdltnlnqivceggsrlrgimvhayttqgyavyapssevsnvscagsgtkkilctyv
adiqggninvqhgenamtlsmrpamggtinpslvltadcqvaspgneasivklsaiqdga
rvgelqlnrlgfkhmsipvaesqlpesalefnssigfffgtddelrilakkpdgtfvtys
l

SCOPe Domain Coordinates for d3riqa_:

Click to download the PDB-style file with coordinates for d3riqa_.
(The format of our PDB-style files is described here.)

Timeline for d3riqa_: