Lineage for d3srea_ (3sre A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065620Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2065691Family b.68.6.2: Serum paraoxonase/arylesterase 1, PON1 [101895] (2 protein domains)
  6. 2065697Protein automated matches [193803] (1 species)
    not a true protein
  7. 2065698Species Artificial gene [TaxId:32630] [193804] (1 PDB entry)
  8. 2065699Domain d3srea_: 3sre A: [193805]
    automated match to d1v04a_
    complexed with br, ca, lmt, po4

Details for d3srea_

PDB Entry: 3sre (more details), 1.99 Å

PDB Description: Serum paraoxonase-1 by directed evolution at pH 6.5
PDB Compounds: (A:) serum paraoxonase

SCOPe Domain Sequences for d3srea_:

Sequence, based on SEQRES records: (download)

>d3srea_ b.68.6.2 (A:) automated matches {Artificial gene [TaxId: 32630]}
fdrqkssfqtrfnvhrevtpvelpncnlvkgidngsedleilpnglafissglkypgims
fdpdksgkillmdlnekepavseleiigntldissfnphgistfidddntvyllvvnhpg
ssstvevfkfqeeeksllhlktirhkllpsvndivavgpehfyatndhyfidpylkswem
hlglawsfvtyyspndvrvvaegfdfanginispdgkyvyiaellahkihvyekhanwtl
tplrvlsfdtlvdnisvdpvtgdlwvgchpngmriffydaenppgsevlriqdilseepk
vtvvyaengtvlqgstvaavykgklligtvfhkalycdl

Sequence, based on observed residues (ATOM records): (download)

>d3srea_ b.68.6.2 (A:) automated matches {Artificial gene [TaxId: 32630]}
fdrqkssfqtrfnvhrevtpvelpncnlvkgidngsedleilpnglafissglkysgkil
lmdlnekepavseleiigntldissfnphgistfidddntvyllvvnhpgssstvevfkf
qeeeksllhlktirhkllpsvndivavgpehfyatndhyfidpylkswemhlglawsfvt
yyspndvrvvaegfdfanginispdgkyvyiaellahkihvyekhanwtltplrvlsfdt
lvdnisvdpvtgdlwvgchpngmriffydaenppgsevlriqdilseepkvtvvyaengt
vlqgstvaavykgklligtvfhkalycdl

SCOPe Domain Coordinates for d3srea_:

Click to download the PDB-style file with coordinates for d3srea_.
(The format of our PDB-style files is described here.)

Timeline for d3srea_: