Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein pak1 [56146] (1 species) OPK group; PAK/STE20 subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56147] (19 PDB entries) |
Domain d4dawa_: 4daw A: [193796] automated match to d1f3mc_ complexed with 0h2 |
PDB Entry: 4daw (more details), 2 Å
SCOPe Domain Sequences for d4dawa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dawa_ d.144.1.7 (A:) pak1 {Human (Homo sapiens) [TaxId: 9606]} sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtp ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe klsaifrdflnrclemdvekrgsakellqhqflkiakplssltpliaaakeatk
Timeline for d4dawa_: