Lineage for d3ux1a_ (3ux1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076263Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 2076282Family b.121.5.2: Parvoviridae-like VP [88646] (3 protein domains)
    automatically mapped to Pfam PF00740
  6. 2076308Protein automated matches [190920] (7 species)
    not a true protein
  7. 2076449Species Adeno-associated virus 9 [TaxId:235455] [193792] (1 PDB entry)
  8. 2076450Domain d3ux1a_: 3ux1 A: [193793]
    automated match to d1lp3a_

Details for d3ux1a_

PDB Entry: 3ux1 (more details), 2.8 Å

PDB Description: Structural Characterization of Adeno-Associated Virus Serotype 9
PDB Compounds: (A:) Capsid protein VP1

SCOPe Domain Sequences for d3ux1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ux1a_ b.121.5.2 (A:) automated matches {Adeno-associated virus 9 [TaxId: 235455]}
dgvgsssgnwhcdsqwlgdrvittstrtwalptynnhlykqisnstsggssndnayfgys
tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevtdnngvktiannl
tstvqvftdsdyqlpyvlgsahegclppfpadvfmipqygyltlndgsqavgrssfycle
yfpsqmlrtgnnfqfsyefenvpfhssyahsqsldrlmnplidqylyylsktingsgqnq
qtlkfsvagpsnmavqgrnyipgpsyrqqrvsttvtqnnnsefawpgasswalngrnslm
npgpamashkegedrffplsgslifgkqgtgrdnvdadkvmitneeeikttnpvatesyg
qvatnhqsaqaqaqtgwvqnqgilpgmvwqdrdvylqgpiwakiphtdgnfhpsplmggf
gmkhpppqilikntpvpadpptafnkdklnsfitqystgqvsveiewelqkenskrwnpe
iqytsnyyksnnvefavntegvyseprpigtryltrnl

SCOPe Domain Coordinates for d3ux1a_:

Click to download the PDB-style file with coordinates for d3ux1a_.
(The format of our PDB-style files is described here.)

Timeline for d3ux1a_: