Lineage for d4epra_ (4epr A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448880Protein automated matches [190047] (29 species)
    not a true protein
  7. 2448966Species Human (Homo sapiens) [TaxId:9606] [186768] (178 PDB entries)
  8. 2449067Domain d4epra_: 4epr A: [193786]
    automated match to d3gftb_
    complexed with gdp, mg

Details for d4epra_

PDB Entry: 4epr (more details), 2 Å

PDB Description: discovery of small molecules that bind to k-ras and inhibit sos- mediated activation.
PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d4epra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4epra_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkh

SCOPe Domain Coordinates for d4epra_:

Click to download the PDB-style file with coordinates for d4epra_.
(The format of our PDB-style files is described here.)

Timeline for d4epra_: