| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
| Protein automated matches [190417] (18 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187294] (314 PDB entries) |
| Domain d4e4ma_: 4e4m A: [193785] automated match to d3q32b_ complexed with 0nh |
PDB Entry: 4e4m (more details), 2.25 Å
SCOPe Domain Sequences for d4e4ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e4ma_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afedrdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrd
fereieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikll
qytsqickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepg
espifwyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmi
vfhliellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag
Timeline for d4e4ma_: