SCOPe 2.05: Domain d4dcda_: 4dcd A:

Lineage for d4dcda_ (4dcd A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein automated matches [190384] (12 species)
   not a true protein

7. Species Human poliovirus 1 [TaxId:12081] [193776] (1 PDB entry)

8. Domain d4dcda_: 4dcd A: [193777]
   automated match to d1l1na_
   complexed with dtt, k36, so4

Details for d4dcda_

PDB Entry: 4dcd, 1.69 Å

PDB Description: 1.6a resolution structure of poliovirus 3c protease containing a covalently bound dipeptidyl inhibitor

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d4dcda_:

Sequence; same for both SEQRES and ATOM records:

>d4dcda_ b.47.1.4 (A:) automated matches {Human poliovirus 1 [TaxId: 12081]}
hhhhgpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkevei
ldakaledqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpv
gavteqgylnlggrqtartlmynfptragqcggvitctgkvigmhvggngshgfaaalkr
syft

Timeline for d4dcda_:

• d4dcda_ first appeared in SCOPe 2.02
  
• d4dcda_ appears in SCOPe 2.04
  
• d4dcda_ is called d4dcda1 in SCOPe 2.06
  
• d4dcda_ appears in the current release, SCOPe 2.08, called d4dcda1