SCOPe 2.08: Domain d4dcda1: 4dcd A:1-180

Lineage for d4dcda1 (4dcd A:1-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Human poliovirus 1 [TaxId:12081] [193776] (1 PDB entry)

8. Domain d4dcda1: 4dcd A:1-180 [193777]
   Other proteins in same PDB: d4dcda2
   automated match to d1l1na_
   complexed with dtt, k36, so4

Details for d4dcda1

PDB Entry: 4dcd, 1.69 Å

PDB Description: 1.6a resolution structure of poliovirus 3c protease containing a covalently bound dipeptidyl inhibitor

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d4dcda1:

Sequence; same for both SEQRES and ATOM records:

>d4dcda1 b.47.1.4 (A:1-180) automated matches {Human poliovirus 1 [TaxId: 12081]}
gpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkeveildak
aledqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavt
eqgylnlggrqtartlmynfptragqcggvitctgkvigmhvggngshgfaaalkrsyft

Timeline for d4dcda1:

• d4dcda1 first appeared in SCOPe 2.02, called d4dcda_
  
• d4dcda1 appears in SCOPe 2.07