Lineage for d4dcda1 (4dcd A:1-180)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2389935Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2390138Protein automated matches [190384] (19 species)
    not a true protein
  7. 2390210Species Human poliovirus 1 [TaxId:12081] [193776] (1 PDB entry)
  8. 2390211Domain d4dcda1: 4dcd A:1-180 [193777]
    Other proteins in same PDB: d4dcda2
    automated match to d1l1na_
    complexed with dtt, k36, so4

Details for d4dcda1

PDB Entry: 4dcd (more details), 1.69 Å

PDB Description: 1.6a resolution structure of poliovirus 3c protease containing a covalently bound dipeptidyl inhibitor
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d4dcda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dcda1 b.47.1.4 (A:1-180) automated matches {Human poliovirus 1 [TaxId: 12081]}
gpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkeveildak
aledqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavt
eqgylnlggrqtartlmynfptragqcggvitctgkvigmhvggngshgfaaalkrsyft

SCOPe Domain Coordinates for d4dcda1:

Click to download the PDB-style file with coordinates for d4dcda1.
(The format of our PDB-style files is described here.)

Timeline for d4dcda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dcda2