SCOPe 2.08: Domain d4gf6b1: 4gf6 B:4-238

Lineage for d4gf6b1 (4gf6 B:4-238)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d4gf6b1: 4gf6 B:4-238 [193775]
   Other proteins in same PDB: d4gf6b2
   automated match to d2hcga_
   complexed with ca, cu

Details for d4gf6b1

PDB Entry: 4gf6, 1.1 Å

PDB Description: crystal structure of gfp with cuprum bound at the incorporated metal chelating amino acid pyz151

PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d4gf6b1:

Sequence; same for both SEQRES and ATOM records:

>d4gf6b1 d.22.1.1 (B:4-238) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
gaelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
fsygvqcfsrypdhmkahdffksampegyvqertisfkddgnyktraevkfegdtlvnri
alkgidfkeagnilghkleynynshnvxitadkqkngikanfkirhniadgsvqladhyq
qntpigagpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdeaya

Timeline for d4gf6b1:

• d4gf6b1 first appeared in SCOPe 2.02, called d4gf6b_
  
• d4gf6b1 appears in SCOPe 2.07