SCOPe 2.05: Domain d4fs3a_: 4fs3 A:

Lineage for d4fs3a_ (4fs3 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein automated matches [190085] (47 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282458] [193773] (1 PDB entry)

8. Domain d4fs3a_: 4fs3 A: [193774]
   automated match to d3gr6j_
   complexed with 0wd, 0we

Details for d4fs3a_

PDB Entry: 4fs3, 1.8 Å

PDB Description: Crystal structure of Staphylococcus aureus enoyl-ACP reductase in complex with NADP and AFN-1252

PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI

SCOPe Domain Sequences for d4fs3a_:

Sequence; same for both SEQRES and ATOM records:

>d4fs3a_ c.2.1.2 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
mlnlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqlnqpea
hlyqidvqsdeevingfeqigkdvgnidgvyhsiafanmedlrgrfsetsregfllaqdi
ssysltivaheakklmpeggsivattylggefavqnynvmgvakasleanvkylaldlgp
dnirvnaisagpirtlsakgvggfntilkeikeraplkrnvdqvevgktaayllsdlssg
vtgenihvdsgfhaik

Timeline for d4fs3a_:

• d4fs3a_ first appeared in SCOPe 2.02
  
• d4fs3a_ appears in SCOPe 2.04
  
• d4fs3a_ appears in SCOPe 2.06
  
• d4fs3a_ appears in the current release, SCOPe 2.08