Lineage for d4g2ia_ (4g2i A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729577Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2729578Species Human (Homo sapiens) [TaxId:9606] [48529] (30 PDB entries)
  8. 2729583Domain d4g2ia_: 4g2i A: [193772]
    automated match to d1ie9a_
    protein/DNA complex; complexed with 0vq

Details for d4g2ia_

PDB Entry: 4g2i (more details), 1.8 Å

PDB Description: Structural basis for the accommodation of bis- and tris-aromatic derivatives in Vitamin D Nuclear Receptor
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d4g2ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g2ia_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
smkltplvlevfg

SCOPe Domain Coordinates for d4g2ia_:

Click to download the PDB-style file with coordinates for d4g2ia_.
(The format of our PDB-style files is described here.)

Timeline for d4g2ia_: