SCOPe 2.05: Domain d4hcua_: 4hcu A:

Lineage for d4hcua_ (4hcu A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
   PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
   Uniprot Q08881 357-619

8. Domain d4hcua_: 4hcu A: [193768]
   automated match to d1sm2a_
   complexed with 13l

Details for d4hcua_

PDB Entry: 4hcu, 1.43 Å

PDB Description: Crystal structure of ITK in complext with compound 40

PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4hcua_:

Sequence; same for both SEQRES and ATOM records:

>d4hcua_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
wvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklsh
pklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmaylee
acvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsry
ssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcw
rerpedrpafsrllrqlaeiaes

Timeline for d4hcua_:

• d4hcua_ first appeared in SCOPe 2.02
  
• d4hcua_ appears in SCOPe 2.04
  
• d4hcua_ appears in SCOPe 2.06
  
• d4hcua_ appears in the current release, SCOPe 2.08