SCOPe 2.07: Domain d4esfa1: 4esf A:3-105

Lineage for d4esfa1 (4esf A:3-105)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Bacillus cereus [TaxId:222523] [188293] (2 PDB entries)

8. Domain d4esfa1: 4esf A:3-105 [193767]
   Other proteins in same PDB: d4esfa2
   automated match to d3hhha_

Details for d4esfa1

PDB Entry: 4esf, 2.2 Å

PDB Description: Crystal structure of PadR-like transcriptional regulator (BCE3449) from Bacillus cereus strain ATCC 10987

PDB Compounds: (A:) PadR-like transcriptional regulator

SCOPe Domain Sequences for d4esfa1:

Sequence, based on SEQRES records:

>d4esfa1 a.4.5.0 (A:3-105) automated matches {Bacillus cereus [TaxId: 222523]}
nltemlkgslegcvleiisrretygyeitrhlndlgftevvegtvytilvrlekkklvni
ekkpsdmgpprkfyslneagrqelelfwkkwdfvsskinvlks

Sequence, based on observed residues (ATOM records):

>d4esfa1 a.4.5.0 (A:3-105) automated matches {Bacillus cereus [TaxId: 222523]}
nltemlkgslegcvleiisrretygyeitrhlndlgftevvegtvytilvrlekkklvni
ekkpprkfyslneagrqelelfwkkwdfvsskinvlks

Timeline for d4esfa1:

• d4esfa1 first appeared in SCOPe 2.02, called d4esfa_
  
• d4esfa1 appears in SCOPe 2.06
  
• d4esfa1 appears in the current release, SCOPe 2.08