Lineage for d4esfa1 (4esf A:3-105)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694563Species Bacillus cereus [TaxId:222523] [188293] (2 PDB entries)
  8. 2694564Domain d4esfa1: 4esf A:3-105 [193767]
    Other proteins in same PDB: d4esfa2
    automated match to d3hhha_

Details for d4esfa1

PDB Entry: 4esf (more details), 2.2 Å

PDB Description: Crystal structure of PadR-like transcriptional regulator (BCE3449) from Bacillus cereus strain ATCC 10987
PDB Compounds: (A:) PadR-like transcriptional regulator

SCOPe Domain Sequences for d4esfa1:

Sequence, based on SEQRES records: (download)

>d4esfa1 a.4.5.0 (A:3-105) automated matches {Bacillus cereus [TaxId: 222523]}
nltemlkgslegcvleiisrretygyeitrhlndlgftevvegtvytilvrlekkklvni
ekkpsdmgpprkfyslneagrqelelfwkkwdfvsskinvlks

Sequence, based on observed residues (ATOM records): (download)

>d4esfa1 a.4.5.0 (A:3-105) automated matches {Bacillus cereus [TaxId: 222523]}
nltemlkgslegcvleiisrretygyeitrhlndlgftevvegtvytilvrlekkklvni
ekkpprkfyslneagrqelelfwkkwdfvsskinvlks

SCOPe Domain Coordinates for d4esfa1:

Click to download the PDB-style file with coordinates for d4esfa1.
(The format of our PDB-style files is described here.)

Timeline for d4esfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4esfa2