Lineage for d4basa_ (4bas A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2873127Species Trypanosoma brucei [TaxId:185431] [193763] (1 PDB entry)
  8. 2873128Domain d4basa_: 4bas A: [193764]
    automated match to d2h57b_
    complexed with gnp, mg, so4

Details for d4basa_

PDB Entry: 4bas (more details), 2 Å

PDB Description: Structure of the Arl6 BBS3 Small GTPase from Trypanosoma brucei with bound nucleotide analogue GppNp
PDB Compounds: (A:) ADP-ribosylation factor, putative (small gtpase, putative)

SCOPe Domain Sequences for d4basa_:

Sequence, based on SEQRES records: (download)

>d4basa_ c.37.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]}
tklqvvmcgldnsgkttiinqvkpaqssskhitatvgynvetfekgrvaftvfdmggakk
frglwetyydnidavifvvdssdhlrlcvvkseiqamlkhedirrelpgggrvpflffan
kmdaagaktaaelveildlttlmgdhpfvifasnglkgtgvhegfswlqetasrqs

Sequence, based on observed residues (ATOM records): (download)

>d4basa_ c.37.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]}
tklqvvmcgldnsgkttiinqvkpaqhitatvgynvetfekgrvaftvfdmggakkfrgl
wetyydnidavifvvdssdhlrlcvvkseiqamlkhedirrelpgggrvpflffankmda
agaktaaelveildlttlmgdhpfvifasnglkgtgvhegfswlqetasrqs

SCOPe Domain Coordinates for d4basa_:

Click to download the PDB-style file with coordinates for d4basa_.
(The format of our PDB-style files is described here.)

Timeline for d4basa_: