Lineage for d4hv3a_ (4hv3 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939585Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1939586Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1939587Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1939687Protein Ricin A-chain [56389] (1 species)
  7. 1939688Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (37 PDB entries)
    Uniprot P06750 28-286
  8. 1939694Domain d4hv3a_: 4hv3 A: [193758]
    automated match to d1br5a_
    complexed with 19l, mla, so4

Details for d4hv3a_

PDB Entry: 4hv3 (more details), 1.54 Å

PDB Description: structure of ricin a chain bound with n-(n-(pterin-7-yl)carbonyl-l- serinyl)-l-tryptophan
PDB Compounds: (A:) ricin

SCOPe Domain Sequences for d4hv3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hv3a_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
mifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfil
velsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfaf
ggnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaa
rfqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngsk
fsvydvsilipiialmvyrcapppssqf

SCOPe Domain Coordinates for d4hv3a_:

Click to download the PDB-style file with coordinates for d4hv3a_.
(The format of our PDB-style files is described here.)

Timeline for d4hv3a_: