Lineage for d4dz0a_ (4dz0 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264992Protein automated matches [190041] (22 species)
    not a true protein
  7. 1265206Species Human (Homo sapiens) [TaxId:9606] [187027] (15 PDB entries)
  8. 1265220Domain d4dz0a_: 4dz0 A: [193756]
    automated match to d2fhaa_
    complexed with aen, ca, cu

Details for d4dz0a_

PDB Entry: 4dz0 (more details), 2.5 Å

PDB Description: Crystal structure of the Cu-adduct of human H-Ferritin variant MIC1 labeled with a dansyl fluorophore
PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d4dz0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dz0a_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmseyfdrddvalknfacyfhhqsheehe
hahklmklqeqrggriflqdiqkadeddwesglnameaalhleknvnqsllelhklatdk
ndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d4dz0a_:

Click to download the PDB-style file with coordinates for d4dz0a_.
(The format of our PDB-style files is described here.)

Timeline for d4dz0a_: