Lineage for d3v62d_ (3v62 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932423Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193751] (7 PDB entries)
  8. 2932432Domain d3v62d_: 3v62 D: [193752]
    Other proteins in same PDB: d3v62b1, d3v62b2, d3v62e1, d3v62e2
    automated match to d1euvb_
    protein/DNA complex; complexed with neq, so4

Details for d3v62d_

PDB Entry: 3v62 (more details), 2.9 Å

PDB Description: structure of the s. cerevisiae srs2 c-terminal domain in complex with pcna conjugated to sumo on lysine 164
PDB Compounds: (D:) Ubiquitin-like protein SMT3

SCOPe Domain Sequences for d3v62d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v62d_ d.15.1.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpe
dldmedndiieahreqigg

SCOPe Domain Coordinates for d3v62d_:

Click to download the PDB-style file with coordinates for d3v62d_.
(The format of our PDB-style files is described here.)

Timeline for d3v62d_: