SCOPe 2.05: Domain d3s67a_: 3s67 A:

Lineage for d3s67a_ (3s67 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (7 proteins)
   automatically mapped to Pfam PF00031

6. Protein Cystatin C [64231] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64232] (9 PDB entries)
   Uniprot P01034 37-146

8. Domain d3s67a_: 3s67 A: [193749]
   automated match to d1g96a_
   complexed with act, cl, imd, peg; mutant

Details for d3s67a_

PDB Entry: 3s67, 2.26 Å

PDB Description: Crystal structure of V57P mutant of human cystatin C

PDB Compounds: (A:) Cystatin-C

SCOPe Domain Sequences for d3s67a_:

Sequence; same for both SEQRES and ATOM records:

>d3s67a_ d.17.1.2 (A:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
vggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqipagvnyfldvelg
rttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

Timeline for d3s67a_:

• d3s67a_ first appeared in SCOPe 2.02
  
• d3s67a_ appears in SCOPe 2.04
  
• d3s67a_ appears in SCOPe 2.06
  
• d3s67a_ appears in the current release, SCOPe 2.08