| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) ![]() has a additional strand at the N-terminus |
| Family d.17.1.2: Cystatins [54407] (7 proteins) automatically mapped to Pfam PF00031 |
| Protein Cystatin C [64231] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [64232] (11 PDB entries) Uniprot P01034 37-146 |
| Domain d3s67a_: 3s67 A: [193749] automated match to d1g96a_ complexed with act, cl, imd, peg; mutant |
PDB Entry: 3s67 (more details), 2.26 Å
SCOPe Domain Sequences for d3s67a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s67a_ d.17.1.2 (A:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
vggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqipagvnyfldvelg
rttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
Timeline for d3s67a_: