| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (22 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries) |
| Domain d3p9wb_: 3p9w B: [193748] Other proteins in same PDB: d3p9wa_, d3p9wc_, d3p9we_, d3p9wg_ automated match to d3b9vd_ |
PDB Entry: 3p9w (more details), 2.41 Å
SCOPe Domain Sequences for d3p9wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p9wb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeelvariyptngytry
adsvkgrftisadtskntaylqmnslraedtavyycyyhyygwhpgyglsyssgqgtlvt
vss
Timeline for d3p9wb_: