SCOPe 2.06: Domain d3p9wb_: 3p9w B:

Lineage for d3p9wb_ (3p9w B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)

8. Domain d3p9wb_: 3p9w B: [193748]
   Other proteins in same PDB: d3p9wa_, d3p9wc_, d3p9we_, d3p9wg_
   automated match to d3b9vd_

Details for d3p9wb_

PDB Entry: 3p9w, 2.41 Å

PDB Description: Crystal structure of an engineered human autonomous VH Domain in complex with VEGF

PDB Compounds: (B:) human VEGF

SCOPe Domain Sequences for d3p9wb_:

Sequence; same for both SEQRES and ATOM records:

>d3p9wb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeelvariyptngytry
adsvkgrftisadtskntaylqmnslraedtavyycyyhyygwhpgyglsyssgqgtlvt
vss

Timeline for d3p9wb_:

• d3p9wb_ first appeared in SCOPe 2.02
  
• d3p9wb_ appears in SCOPe 2.05
  
• d3p9wb_ appears in SCOPe 2.07
  
• d3p9wb_ appears in the current release, SCOPe 2.08