| Class g: Small proteins [56992] (92 folds) |
| Fold g.49: Cysteine-rich domain [57888] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) ![]() |
| Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins) Pfam PF00130 |
| Protein automated matches [193184] (2 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries) |
| Domain d3ueyb_: 3uey B: [193744] automated match to d1ptqa_ complexed with po4, zn |
PDB Entry: 3uey (more details), 1.3 Å
SCOPe Domain Sequences for d3ueyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ueyb_ g.49.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsrrasvgshrfkvfnymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlce
fivtd
Timeline for d3ueyb_: