Lineage for d3ueyb_ (3uey B:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1967166Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1967167Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 1967168Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 1967191Protein automated matches [193184] (2 species)
    not a true protein
  7. 1967194Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries)
  8. 1967204Domain d3ueyb_: 3uey B: [193744]
    automated match to d1ptqa_
    complexed with po4, zn

Details for d3ueyb_

PDB Entry: 3uey (more details), 1.3 Å

PDB Description: structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
PDB Compounds: (B:) protein kinase c delta type

SCOPe Domain Sequences for d3ueyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ueyb_ g.49.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsrrasvgshrfkvfnymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlce
fivtd

SCOPe Domain Coordinates for d3ueyb_:

Click to download the PDB-style file with coordinates for d3ueyb_.
(The format of our PDB-style files is described here.)

Timeline for d3ueyb_: